missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC22A12 Partial ORF (NP_653186.2, 281 a.a. - 349 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00116085-Q02.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRSpecifica
| NP_653186.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.33kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR | |
| RUO | |
| SLC22A12 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 116085 | |
| SLC22A12 (Human) Recombinant Protein (Q02) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| OAT4L/RST/URAT1 | |
| SLC22A12 | |
| Recombinant | |
| wheat germ expression system |