missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC5A2 Partial ORF (NP_003032.1, 228 a.a. - 277 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00006524-Q01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. [provided by RefSeq]
Sequence: GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPSpecifica
| NP_003032.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.24kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP | |
| RUO | |
| SLC5A2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6524 | |
| SLC5A2 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SGLT2 | |
| SLC5A2 | |
| Recombinant | |
| wheat germ expression system |