Abnova™ Human SNX22 Partial ORF (NP_079074, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00079856-Q01.25ug

Codice prodotto. 16124563

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

Sequence: MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHF

Specifica

Numero di accesso	NP_079074
Formulazione	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecolare	37.84kDa
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogeno	MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHF
Status giuridico	RUO
Nome comune	SNX22
Specie	Wheat Germ (in vitro)
Tag proteine	GST
Forma	Liquid

Da utilizzare con (applicazione)	Antibody Production, ELISA, Protein Array, Western Blot
ID gene (immissione)	79856
Nome	SNX22 (Human) Recombinant Protein (Q01)
Quantità	25 ug
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias gene	FLJ13952
Simbolo del gene	SNX22
Recombinant	Recombinant
Sistema di espressione	wheat germ expression system

Suggerimenti di prodotto

Descrizione