missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TPRX1 Partial ORF (NP_940881.2, 313 a.a. - 411 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00284355-Q01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the TPRX homeobox gene family. [provided by RefSeq]
Sequence: GSGSVPAPIPGPGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPLDPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLLDLSpecifica
| NP_940881.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| GSGSVPAPIPGPGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPLDPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLLDL | |
| RUO | |
| TPRX1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 284355 | |
| TPRX1 (Human) Recombinant Protein (Q01) | |
| 10 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ40321/TPRX | |
| TPRX1 | |
| Recombinant | |
| wheat germ expression system |