missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TRPA1 Partial ORF (NP_015628, 1033 a.a. - 1117 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00008989-Q01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. [provided by RefSeq]
Sequence: IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLSpecifica
| NP_015628 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.09kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL | |
| RUO | |
| TRPA1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8989 | |
| TRPA1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ANKTM1 | |
| TRPA1 | |
| Recombinant | |
| wheat germ expression system |