missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UCHL3 Full-length ORF (AAH18125, 1 a.a. - 230 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00007347-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16131722

  • 335.00€ / 10µg
Spedizione stimata: 28-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

Sequence: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Specifica

Specifica

AAH18125
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
50.82kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
UCH-L3
UCHL3
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
7347
UCHL3 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
RUO
UCHL3
Wheat Germ (in vitro)
GST
Liquid
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali