missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZFP36L1 Partial ORF (NP_004917, 1 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
| Numero di accesso | NP_004917 |
|---|---|
| Da utilizzare con (applicazione) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID gene (immissione) | 677 |
| Peso molecolare | 37.62kDa |
| Product Code | Brand | Quantità | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantità | Price | Quantity & Availability | |||||
|
16162341
|
Abnova™
H00000677-Q01.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 07-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
|
16152341
|
Abnova™
H00000677-Q01.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 07-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Description
This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. [provided by RefSeq]
Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGSpecifications
| NP_004917 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.62kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BRF1/Berg36/ERF-1/ERF1/RNF162B/TIS11B/cMG1 | |
| ZFP36L1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 677 | |
| ZFP36L1 (Human) Recombinant Protein (Q01) | |
| MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG | |
| RUO | |
| ZFP36L1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |