missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ IL1RN (Human) Recombinant Protein
Human IL1RN full-length ORF ( AAH09745, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00003557-P01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
- Sequence: MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Specifica
| AAH09745 | |
| interleukin 1 receptor antagonist | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| IL1RN | |
| GST |
| 3557 | |
| Wheat germ expression system | |
| 25 μg | |
| ICIL-1RA, IL-1ra3, IL1F3, IL1RA, IRAP, MGC10430 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |