missing translation for 'onlineSavingsMsg'
Learn More

JAG1 (Human) Recombinant Protein (Q01), Abnova

Human JAG1 partial ORF with GST-tag at N-terminal

Marca:  Abnova H00000182-Q01.25ug

Dettagli aggiuntivi : Peso : 0.02000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16013605

  • 482.88€ / 25µg


Spedizione stimata
07-06-2021
Aggiungi al carrello

Descrizione

Descrizione

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.

  • Theoretical MW: 35.64kDa
  • Preparation Method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Specifica

Specifica

NP_000205
Solution
182
JAG1 (Human) Recombinant Protein (Q01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
JAG1
Human
Yes
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
35.64
8
Glutathione Sepharose 4 Fast Flow
25 ug
PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG
AGS|AHD|AWS|CD339|HJ1|JAGL1|MGC104644
JAG1
Wheat Germ (in vitro)
GST
Videos
SDS
Documenti