missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ LRRFIP1 Recombinant Protein

Marca:  Abnova™ H00009208-P01.10ug

Dettagli aggiuntivi : Peso : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16173392

  • 335.00€ / 10µg
Spedizione stimata: 28-08-2024
per visualizzare lo stock disponibile

Descrizione

Descrizione

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifica

Specifica

AAH10662
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
37.7
8
Glutathione Sepharose 4 Fast Flow
10 ug
MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
FLAP-1/FLIIAP1/GCF-2/GCF2/HUFI-1/MGC10947/MGC119738/MGC119739/TRIP
LRRFIP1
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
9208
LRRFIP1 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LRRFIP1
Human
Recombinant
Solution
Suggerimenti di prodotto

Suggerimenti di prodotto

Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali