missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NRAS (Human) Recombinant Protein
Human NRAS full-length ORF ( NP_002515.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00004893-P01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
- Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
Specifica
| NP_002515.1 | |
| neuroblastoma RAS viral (v-ras) oncogene homolog | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NRAS | |
| GST |
| 4893 | |
| Wheat germ expression system | |
| 25 μg | |
| ALPS4, N-ras, NRAS1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |