missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PRL R Protein

A cDNA sequence encoding the PRL R was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP10846-5ug

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15945348

  • 120.00€ / 5µg

Spedizione stimata: 31-01-2023
per visualizzare lo stock disponibile
Aggiungi al carrello

Descrizione

Descrizione

Specifica

Specifica

PRL R Protein
5 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
Research Use Only
Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Human
Untagged
The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3.
Videos
SDS
Documenti
Certificati
Offerte speciali

Offerte speciali