missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other protein 1

A cDNA sequence encoding the Protein G was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13162-1mg

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15902699

  • 120.00€ / 1mg

Spedizione stimata: 31-03-2023
per visualizzare lo stock disponibile
Aggiungi al carrello

Descrizione

Descrizione

Specifica

Specifica

protein 1
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
Untagged
Lyophilized white powder containing no additives.
>96% as determined by SDS-PAGE and RP-HPLC.
Research Use Only
Recombinant Protein
E. coli
LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali