missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat Tpc1808 Protein

A cDNA sequence encoding the Tpc1808 was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13791-10ug

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15914719

  • 120.00€ / 10µg

Spedizione stimata: 03-04-2023
per visualizzare lo stock disponibile
Aggiungi al carrello

Descrizione

Descrizione

Specifica

Specifica

Tpc1808 Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Videos
SDS
Documenti

Documenti

Certificati
Offerte speciali

Offerte speciali