missing translation for 'onlineSavingsMsg'
Learn More
Learn More
T-box 19 Antibody (CL6251), Novus Biologicals™
Mouse Monoclonal Antibody
Marca: Novus Biologicals NBP2-61438-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
T-box 19 Monoclonal specifically detects T-box 19 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
| T-box 19 | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
| TBX19 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG1 |
| Immunohistochemistry (Paraffin), Immunohistochemistry | |
| CL6251 | |
| Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| dJ747L4.1, FLJ26302, FLJ34085, T-box 19, T-box factor, pituitary, T-box protein 19, T-box transcription factor TBX19, TBS 19, TBS19, TPITFLJ34543 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| 9095 | |
| Human | |
| Purified |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto