missing translation for 'onlineSavingsMsg'
Learn More
Learn More
T-box 19 Antibody (CL6251), Novus Biologicals™
Mouse Monoclonal Antibody
443.00€ - 665.00€
Specifica
| Antigene | T-box 19 |
|---|---|
| Clone | CL6251 |
| Diluizione | Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Classificazione | Monoclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18042816
|
Novus Biologicals
NBP2-61438 |
100 μL |
665.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18619888
|
Novus Biologicals
NBP2-61438-25ul |
25 μL |
443.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
T-box 19 Monoclonal specifically detects T-box 19 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifica
| T-box 19 | |
| Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Unconjugated | |
| Mouse | |
| dJ747L4.1, FLJ26302, FLJ34085, T-box 19, T-box factor, pituitary, T-box protein 19, T-box transcription factor TBX19, TBS 19, TBS19, TPITFLJ34543 | |
| TBX19 | |
| IgG1 | |
| Protein A purified |
| CL6251 | |
| Monoclonal | |
| Purified | |
| Human | |
| 9095 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto