missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBIAD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-55187
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
UBIAD1 Polyclonal specifically detects UBIAD1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifica
| UBIAD1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| EC 2.5.1.-, RP4-796F18.1, SCCD, Schnyder crystalline corneal dystrophy, TERE1transitional epithelia response protein, Transitional epithelial response protein 1, UbiA prenyltransferase domain containing 1, ubiA prenyltransferase domain-containing protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| UBIAD1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR | |
| 100 μL | |
| Cancer | |
| 29914 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto