missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBIAD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
337.00€ - 750.00€
Specifica
| Antigene | UBIAD1 |
|---|---|
| Applicazioni | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Specie ospite | Rabbit |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18227234
|
Novus Biologicals
NBP2-55187 |
100 μL |
750.00€
100µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18611109
|
Novus Biologicals
NBP2-55187-25ul |
25 μL |
337.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
UBIAD1 Polyclonal specifically detects UBIAD1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifica
| UBIAD1 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 29914 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.5.1.-, RP4-796F18.1, SCCD, Schnyder crystalline corneal dystrophy, TERE1transitional epithelia response protein, Transitional epithelial response protein 1, UbiA prenyltransferase domain containing 1, ubiA prenyltransferase domain-containing protein 1 | |
| UBIAD1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto