missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ACYP1 (Human) Recombinant Protein
Human ACYP1 full-length ORF ( AAH35568, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00000097-P01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
- Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Specifica
| AAH35568 | |
| acylphosphatase 1, erythrocyte (common) type | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ACYP1 | |
| GST |
| 97 | |
| Wheat germ expression system | |
| 25 μg | |
| ACYPE | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |