Learn More
Abnova™ AIG1 Recombinant Protein
Human AIG1 full-length ORF recombinant protein with GST-tag at N-terminal
Marca: Abnova™ H00051390-P01.25ug
Dettagli aggiuntivi : Peso : 0.00010kg
Descrizione
- Theoretical MW (kDa): 51.92
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MALVPCQALRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQERERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQHPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPF
LEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLE
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica
AAH25278 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
51.92 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
AIG1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
51390 | |
AIG1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
AIG-1/DKFZp686F03136/FLJ10485/dJ95L4.1 | |
AIG1 | |
Wheat Germ (in vitro) | |
GST |