missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HFE2 Partial ORF (NP_973733, 93 a.a. - 173 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00148738-Q01.25ug
This item is not returnable.
View return policy
Description
The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq]
Sequence: GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSSpecifications
| NP_973733 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.65kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS | |
| RUO | |
| HFE2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 148738 | |
| HFE2 (Human) Recombinant Protein (Q01) | |
| 25 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HFE2A/HJV/JH/MGC23953/RGMC | |
| HFE2 | |
| Recombinant | |
| wheat germ expression system |