missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Hepatitis B HBsAg preS2 Protein
A cDNA sequence encoding the HBsAg preS2 was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP12129-1mg
Dettagli aggiuntivi : Peso : 0.01000kg
Specifica
Hepatitis B HBsAg preS2 Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Hepatitis B | |
Untagged | |
HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4 and 50mM NaCl. |