missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Mouse IL17E Protein
A cDNA sequence encoding the IL17E was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP10725-5ug
Dettagli aggiuntivi : Peso : 0.01000kg
Specifica
140806 | |
5 μg | |
< 1.0 EU per ug protein as determined by the LAL method. | |
The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml. | |
Mouse | |
Untagged | |
IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives. |
IL17E Protein | |
Research Use Only | |
Il25 | |
Recombinant Protein | |
E. coli | |
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |