missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant other Pramlintide Protein
A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP13132-1mg
Dettagli aggiuntivi : Peso : 0.01000kg
Specifica
Pramlintide Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 | |
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Other | |
Untagged | |
The protein was lyophilized with no additives. |