missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Pramlintide Protein

A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.

Marca:  enQuireBio™ QP13132-1mg

Dettagli aggiuntivi : Peso : 0.01000kg

 vedi altre versioni di questo prodotto

Codice prodotto. 15952599

  • 120.00€ / 1mg

Spedizione stimata: 01-02-2023
per visualizzare lo stock disponibile
Aggiungi al carrello

Descrizione

Descrizione

Specifica

Specifica

Pramlintide Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
Untagged
The protein was lyophilized with no additives.
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Videos
SDS
Documenti
Certificati
Offerte speciali

Offerte speciali