missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human OTOF Partial ORF (NP_919224.1, 1 a.a. - 98 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Specifica
Numero di accesso | NP_919224.1 |
---|---|
Da utilizzare con (applicazione) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID gene (immissione) | 9381 |
Peso molecolare | 36.52kDa |
Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
---|---|---|---|---|---|---|---|---|---|
Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
16160526
|
Abnova™
H00009381-Q01.10UG |
10 ug |
335.00€
10µg |
Spedizione stimata: 07-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
16170526
|
Abnova™
H00009381-Q01.25UG |
25 ug |
508.00€
25µg |
Spedizione stimata: 07-06-2024 Eseguire il login per visualizzare lo stock disponibile |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | ||||
Descrizione
Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has 3 C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has 6 C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq]
Sequence: MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDSpecifica
NP_919224.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.52kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DFNB6/DFNB9/FER1L2/NSRD9 | |
OTOF | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
9381 | |
OTOF (Human) Recombinant Protein (Q01) | |
MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTD | |
RUO | |
OTOF | |
Wheat Germ (in vitro) | |
GST | |
Liquid |