All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (1)
- (272)
- (34)
- (42)
- (41)
- (1)
- (49)
- (188)
- (87)
- (1)
- (259)
- (36)
- (1)
- (3)
- (23)
- (6)
- (351)
- (7)
- (1)
- (17)
- (18)
- (17)
- (17)
- (17)
- (18)
- (18)
- (18)
- (22)
- (8)
- (17)
- (17)
- (15)
- (16)
- (12)
- (16)
- (16)
- (18)
- (15)
- (19)
- (4)
- (10)
- (2)
- (2)
- (13)
- (3)
- (7)
- (1)
- (1)
- (1)
- (5)
- (174)
- (8)
- (7)
- (9)
- (13)
- (307)
- (250)
- (2)
- (14)
- (341)
- (238)
- (6)
- (1)
- (6)
- (3)
- (2)
- (2)
- (366)
- (8)
- (50)
- (3)
- (53)
- (31)
- (3)
- (3)
- (1)
- (2)
- (3)
- (16)
- (5)
- (1)
- (22)
- (3)
- (1)
Risultati della ricerca filtrata
| ID gene (immissione) | 134864 |
|---|---|
| Specie ospite | Rabbit |
| Immunogeno | This antibody was developed against a recombinant protein corresponding to amino acids: KEQARLISDANQKLQIGLEMKNGISQSKER |
| N. accesso geni | Q96RJ0 |
| Target Species | Human |
| Applicazioni | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | MGC126874, MGC138399, TA1RP11-295F4.9, TaR-1, TAR1trace amine-associated receptor 1, trace amine associated receptor 1, Trace amine receptor 1taR-1, TRAR1 |
| Isotype | IgG |
| Test di specificità | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Antigene | Trace Amine Receptor 1 |
| Metodo di purificazione | Affinity Purified |
| Simboli geni | TAAR1 |
| Status giuridico | RUO |
| Formulazione | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Disciplina di ricerca | GPCR |
| Diluizione | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Primario o secondario | Primary |
Trace Amine Receptor 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
| ID gene (immissione) | 134864 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunogeno | A portion of amino acids 200-230 of human TAAR1 was used as the immunogen |
| N. accesso geni | Q96RJ0 |
| Target Species | Human,Mouse,Rat,Primate |
| Applicazioni | Western Blot,Immunohistochemistry (Paraffin) |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | MGC126874, MGC138399, TA1RP11-295F4.9, TaR-1, TAR1trace amine-associated receptor 1, trace amine associated receptor 1, Trace amine receptor 1taR-1, TRAR1 |
| Isotype | IgG |
| Test di specificità | The amino acid sequence used as immunogen is 100% homologous in human and chimpanzee, 93% homologous in rhesus monkey, 86% homologous in dog and 50% homologous in mouse and rat. |
| Forma | Purified |
| Antigene | Trace Amine Receptor 1 |
| Metodo di purificazione | Protein G purified |
| Simboli geni | TAAR1 |
| Status giuridico | RUO |
| Formulazione | PBS with 0.05% Sodium Azide |
| Disciplina di ricerca | GPCR |
| Diluizione | Western Blot 1-3 ug/ml, Immunohistochemistry-Paraffin |
| Concentrazione | 1.0 mg/mL |
| Primario o secondario | Primary |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Forma | Purified |
| Applicazioni | Western Blot |
| Antigene | Trace Amine Receptor 1 |
| Isotype | IgG |
| ID gene (immissione) | 134864 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
| Immunogeno | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TAAR1 (NP_612200.1). TSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFY |
| Target Species | Human,Mouse,Rat |
| Applicazioni | Western Blot |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | MGC126874, MGC138399, TA1RP11-295F4.9, TaR-1, TAR1trace amine-associated receptor 1, trace amine associated receptor 1, Trace amine receptor 1taR-1, TRAR1 |
| Isotype | IgG |
| Forma | Purified |
| Antigene | Trace Amine Receptor 1 |
| Metodo di purificazione | Affinity purified |
| Status giuridico | RUO |
| Formulazione | PBS (pH 7.3), 50% glycerol |
| Disciplina di ricerca | GPCR |
| Diluizione | Western Blot 1:500-1:2000 |
| Primario o secondario | Primary |
Invitrogen™ TAAR6 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TAAR1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TAAR6 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TAAR8 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TAAR6 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TAAR8 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ TAAR6 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody