All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (13)
- (6)
- (35,999)
- (17,364)
- (477)
- (2)
- (68)
- (2)
- (46)
- (1,087)
- (27)
- (2)
- (64)
- (791)
- (3)
- (26,791)
- (21,402)
- (2,705)
- (861)
- (2)
- (115)
- (193)
- (171)
- (277)
- (30)
- (96)
- (36,908)
- (976)
- (78)
- (7)
- (380)
- (77)
- (330)
- (19)
- (279)
- (24)
- (1)
- (132)
- (87)
- (1)
- (1)
- (3,789)
- (5,072)
- (61)
- (472)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (3)
- (63)
- (11)
- (2)
- (1)
- (206)
- (264)
- (11)
- (123)
- (80)
- (538)
- (482)
- (168)
- (2)
- (5)
- (75)
- (67)
- (1)
- (486)
- (37)
- (128)
- (1)
- (2)
- (216)
- (827)
- (1)
- (28)
- (116)
- (183)
- (1)
- (132)
- (1)
- (1,125)
- (290)
- (1)
- (1)
- (1,307)
- (1,319)
- (1,335)
- (1)
- (1,284)
- (2)
- (1,299)
- (1,339)
- (1,335)
- (1,306)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (1,655)
- (5)
- (5)
- (19)
- (16)
- (15)
- (20)
- (20)
- (19)
- (15)
- (18)
- (2)
- (15)
- (15)
- (17)
- (23)
- (17)
- (19)
- (1)
- (1,327)
- (2)
- (2)
- (1,426)
- (1,437)
- (1,447)
- (1)
- (1,448)
- (1,412)
- (1)
- (1,439)
- (1,444)
- (1,447)
- (1,660)
- (10)
- (14)
- (2)
- (1,410)
- (670)
- (1,347)
- (353)
- (353)
- (1,351)
- (665)
- (10)
- (2)
- (4)
- (4)
- (2)
- (11)
- (13)
- (1)
- (4)
- (2)
- (5)
- (4)
- (5)
- (4)
- (2)
- (2)
- (11)
- (10)
- (1)
- (2)
- (13)
- (1,251)
- (2)
- (12)
- (287)
- (293)
- (288)
- (1)
- (1,106)
- (4)
- (60)
- (1)
- (1)
- (12,921)
- (4)
- (987)
- (988)
- (980)
- (4)
- (9)
- (2)
- (24)
- (22)
- (24)
- (34)
- (63)
- (1)
- (1)
- (4,177)
- (17)
- (14)
- (4)
- (14,423)
- (255)
- (256)
- (255)
- (20)
- (19,646)
- (42)
- (596)
- (674)
- (8)
- (4)
- (307)
- (2)
- (6)
- (10)
- (214)
- (118)
- (9,392)
- (2,557)
- (11,298)
- (20,098)
- (23)
- (3,240)
- (1)
- (86)
- (20,267)
- (5)
- (31)
- (3,164)
- (2)
- (14)
- (15)
- (26)
- (11)
- (20)
- (424)
- (1)
- (8)
- (5)
- (5)
- (2)
- (9)
- (556)
- (4)
- (51)
- (8)
- (462)
- (11)
- (22)
- (3)
- (103)
- (144)
- (25)
- (6)
- (259)
- (13)
- (7)
- (26)
- (30,140)
- (1)
- (14)
Risultati della ricerca filtrata
Invitrogen™ Nuclear Membrane Monoclonal Antibody (IPO-38)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ Nuclear Membrane Monoclonal Antibody (1415-1 (21NC85))
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Invitrogen™ P110 (mitochondrial membrane protein) Monoclonal Antibody (2G2)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Sars Membrane Protein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
| ID gene (immissione) | 1489672 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunogeno | The antibody was developed by immunizing rabbits with a synthetic peptide corresponding to amino acids 195-210 (YSRYRIGNYKLNTDH) from the M (Membrane protein) for the Human SARS coronavirus (Genbank accession no. YP_009724393.1) |
| N. accesso geni | P59596 |
| Target Species | SARS-CoV |
| Applicazioni | Western Blot,Immunocytochemistry,Immunofluorescence |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein, SARS coronavirus M protein, SARS coronavirus Membrane protein, SARS CoV, SARS CoV M glycoprotein, SARS CoV Matrix protein, Sars M, Sars Matrix Protein, SARSCoV, SARS-CoV M protein, SARS-CoV Membrane protein, Severe acute respiratory syndrome |
| Isotype | IgG |
| Test di specificità | The NCBI accession number of the SARS matrix protein is NP_828855.1. |
| Forma | Purified |
| Antigene | Sars Membrane Protein |
| Metodo di purificazione | Protein G purified |
| Status giuridico | RUO |
| Formulazione | PBS containing 0.2% gelatin with 0.05% Sodium Azide |
| Diluizione | Western Blot 0.5-2 ug/ml, Immunocytochemistry/Immunofluorescence reported by customer review |
| Concentrazione | 1.0 mg/mL |
| Primario o secondario | Primary |
| Specie ospite | Mouse |
|---|---|
| Content And Storage | Store at 4C. |
| Immunogeno | Nuclei of myeloid leukemia biopsy cells |
| Target Species | Human |
| Applicazioni | Flow Cytometry,Immunocytochemistry |
| Coniugato | Unconjugated |
| Classificazione | Monoclonal |
| Isotype | IgG1 κ |
| Forma | Purified |
| Antigene | Nuclear Membrane Marker |
| Metodo di purificazione | Protein A or G purified |
| Status giuridico | RUO |
| Formulazione | 10 mM PBS with 0.05% BSA |
| Diluizione | Flow Cytometry 1-2 ug/million cells, Immunocytochemistry/ Immunofluorescence 1-2 ug/mL |
| Concentrazione | 0.2 mg/mL |
| Primario o secondario | Primary |
| Clone | NM97 |
| Specie ospite | Mouse |
|---|---|
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunogeno | Purified recombinant fragment of SARS-m protein expressed in E. Coli. |
| Target Species | Virus |
| Applicazioni | Western Blot |
| Coniugato | Unconjugated |
| Classificazione | Monoclonal |
| Isotype | IgG1 |
| Test di specificità | Specific for SARS-M. |
| Forma | Supernatant |
| Antigene | Sars M |
| Metodo di purificazione | Tissue culture supernatant |
| Formulazione | Subclonal supernatant with No Preservative |
| Diluizione | Western Blot 1:500-1:2000, ELISA 1:10000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
| Primario o secondario | Primary |
| Clone | 2H2C4 |
Cytochrome b5 Outer Mitochondrial Membrane Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
| ID gene (immissione) | 80777 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunogeno | This antibody was developed against Recombinant Protein corresponding to amino acids:EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD |
| Target Species | Human |
| Applicazioni | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | CYB5M, CYB5-M, CYPB5M, Cytochrome b5 outer mitochondrial membrane isoform, cytochrome b5 type B, cytochrome b5 type B (outer mitochondrial membrane), DKFZp686M0619, OMB5, outer mitochondrial membrane cytochrome b5, type 2 cyt-b5 |
| Isotype | IgG |
| Test di specificità | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Antigene | Cytochrome b5 Outer Mitochondrial Membrane |
| Metodo di purificazione | Affinity Purified |
| Simboli geni | CYB5B |
| Status giuridico | RUO |
| Formulazione | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Diluizione | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
| Primario o secondario | Primary |
| ID gene (immissione) | 1489672 |
|---|---|
| Specie ospite | Rabbit |
| Immunogeno | The antibody was developed by immunizing rabbits with a synthetic peptide corresponding to a 13 aa peptide from within the first 50 amino acids from the M (Membrane protein) for the human SARS coronavirus (Genbank accession no. AFR58746.1) Amino Acid Squence: ADNGTITVEELKQ |
| N. accesso geni | P59596 |
| Target Species | SARS-CoV |
| Applicazioni | ELISA |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein, SARS coronavirus M protein, SARS coronavirus Membrane protein, SARS CoV, SARS CoV M glycoprotein, SARS CoV Matrix protein, Sars M, Sars Matrix Protein, SARSCoV, SARS-CoV M protein, SARS-CoV Membrane protein, Severe acute respiratory syndrome |
| Isotype | IgG |
| Antigene | Sars Membrane Protein |
| Metodo di purificazione | Affinity Purified |
| Status giuridico | RUO |
| Formulazione | PBS with 0.02% Sodium Azide |
| Concentrazione | 1 mg/mL |
| Primario o secondario | Primary |
| ID gene (immissione) | 43740571 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at -20°C. |
| Immunogeno | Recombinant Protein |
| Target Species | Virus |
| Applicazioni | ELISA |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Isotype | IgG |
| Forma | Liquid |
| Antigene | SARS-CoV-2 Membrane Glycoprotein |
| Product Type | Polyclonal Antibody |
| Metodo di purificazione | Antigen affinity purification |
| Status giuridico | RUO |
| Concentrazione | 580 μg/mL |
| Primario o secondario | Primary |
| ID gene (immissione) | 80777 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunogeno | Produced in rabbits immunized with E. coli-derived Human Cytochrome b5 Outer Mitochondrial Membrane fragment. |
| Target Species | Human |
| Applicazioni | Immunohistochemistry (Paraffin) |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | CYB5M, CYB5-M, CYPB5M, Cytochrome b5 outer mitochondrial membrane isoform, cytochrome b5 type B, cytochrome b5 type B (outer mitochondrial membrane), DKFZp686M0619, OMB5, outer mitochondrial membrane cytochrome b5, type 2 cyt-b5 |
| Isotype | IgG |
| Forma | Purified |
| Antigene | Cytochrome b5 Outer Mitochondrial Membrane |
| Metodo di purificazione | Antigen and protein A Affinity-purified |
| Status giuridico | RUO |
| Formulazione | PBS (pH 7.0) |
| Disciplina di ricerca | Cancer, Endocrinology, Signal Transduction |
| Diluizione | Immunohistochemistry-Paraffin 1:50-1:200 |
| Primario o secondario | Primary |
| Specie ospite | Mouse |
|---|---|
| Content And Storage | Store at 4°C. |
| Immunogeno | Nuclei of myeloid leukemia biopsy cells |
| Target Species | Human |
| Applicazioni | Immunofluorescence |
| Coniugato | Unconjugated |
| Classificazione | Monoclonal |
| Isotype | IgG1 κ |
| Forma | Purified |
| Antigene | Nuclear Membrane Marker |
| Metodo di purificazione | Protein A or G purified |
| Status giuridico | RUO |
| Formulazione | 10 mM PBS with 0.05% BSA |
| Diluizione | Immunocytochemistry/ Immunofluorescence 1-2 μg/ml |
| Concentrazione | 0.2 mg/mL |
| Primario o secondario | Primary |
| Clone | AE-5 |
| ID gene (immissione) | 1489672 |
|---|---|
| Specie ospite | Rabbit |
| Immunogeno | Antibody was raised against a synthetic peptide corresponding to 15 amino acids at the carboxy terminus of the SARS matrix protein. The immunogen is located within the last 50 amino acids of SARS Matrix. Amino Acid Squence: GNYKLNTDHAGSNDN |
| N. accesso geni | P59596 |
| Target Species | SARS-CoV |
| Applicazioni | Western Blot,ELISA |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein, SARS coronavirus M protein, SARS coronavirus Membrane protein, SARS CoV, SARS CoV M glycoprotein, SARS CoV Matrix protein, Sars M, Sars Matrix Protein, SARSCoV, SARS-CoV M protein, SARS-CoV Membrane protein, Severe acute respiratory syndrome |
| Isotype | IgG |
| Antigene | Sars Membrane Protein |
| Metodo di purificazione | Affinity Purified |
| Status giuridico | RUO |
| Formulazione | PBS with 0.02% Sodium Azide |
| Concentrazione | 1 mg/mL |
| Primario o secondario | Primary |
| ID gene (immissione) | 4311 |
|---|---|
| Specie ospite | Mouse |
| Content And Storage | Short term: Store at 2-4°C. Long term, aliquot and store at -20°C. |
| Immunogeno | Recombinant human CD10 protein fragment (aa297-483) |
| Applicazioni | Immunohistochemistry |
| Coniugato | Unconjugated |
| Peso molecolare dell'antigene | 100kDa |
| Classificazione | Monoclonal |
| Isotype | IgG2c κ |
| Controllo positivo | Kidney, Prostate or Small Intestine |
| Localizzazione cellulare | Cell Surface and Cytoplasmic |
| Antigene | CD10 (Membrane Metalloendopeptidase) |
| Metodo di purificazione | Protein A/G purified from Bioreactor concentrate. |
| Status giuridico | RUO |
| Formulazione | 10mM PBS with 0.05% BSA and 0.05% azide. Also available without BSA and Azide. |
| Concentrazione | 200μg/mL |
| Primario o secondario | Primary |
| Clone | MME/1870 |
| ID gene (immissione) | 284361 |
|---|---|
| Specie ospite | Rabbit |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunogeno | This antibody was developed against a recombinant protein corresponding to amino acids: DQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKN |
| N. accesso geni | Q5UCC4 |
| Target Species | Human |
| Applicazioni | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Coniugato | Unconjugated |
| Classificazione | Polyclonal |
| Alias gene | C19orf63, Chromosome 19 Open Reading Frame 63, EMC10, Hematopoietic Signal Peptide-Containing Membrane Domain-Containing 1, Hematopoietic Signal Peptide-Containing Membrane Domain-Containing Protein 1, Hematopoietic Signal Peptide-Containing Secreted 1, HSM1, HSS1, INM02, UPF0510 Protein INM02 |
| Isotype | IgG |
| Test di specificità | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Antigene | ER Membrane Protein Complex Subunit 10 |
| Metodo di purificazione | Affinity Purified |
| Simboli geni | EMC10 |
| Status giuridico | RUO |
| Formulazione | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Diluizione | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Primario o secondario | Primary |
SARS-CoV-2 Membrane Antibody, R&D Systems™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Specie ospite | Mouse |
|---|---|
| Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70°C as supplied. 1 month, 2 to 8°C under sterile conditions after reconstitution. 6 months, -20 to -70°C under sterile conditions after reconstitution. |
| Immunogeno | E. coli-derived SARS-CoV-2 membrane (M) protein, Met101-His222, Accession # YP_009724369 |
| N. accesso geni | YP_009724369 |
| Target Species | SARS-CoV-2 |
| Applicazioni | Immunohistochemistry,Immunocytochemistry |
| Coniugato | Unconjugated |
| Classificazione | Monoclonal |
| Isotype | IgG2b |
| Ricostituzione | Reconstitute at 0.5 mg/mL in sterile PBS. |
| Forma | Purified |
| Antigene | Membrane |
| Metodo di purificazione | Protein A or G purified from hybridoma culture supernatant |
| Status giuridico | RUO |
| Formulazione | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. |
| Diluizione | Immunohistochemistry 3-25 ug/mL, Immunocytochemistry 8-25 ug/mL |
| Primario o secondario | Primary |
| Clone | 1041508 |